Amycolatopsis albispora: A4R43_02325 Help Entry A4R43_02325       CDS       T05547                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism aab  Amycolatopsis albispora Pathway aab00261   Monobactam biosynthesis aab01100   Metabolic pathways aab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A4R43_02325  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aab01008]     A4R43_02325 Polyketide biosynthesis proteins [BR:aab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A4R43_02325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXB48220 UniProt:  A0A344LJJ6 LinkDB All DBs Position complement(460861..461055) Genome browser AA seq 64 aa AA seqDB search MMNPFDDPEGRFLVLVNDEEQHSLWPSRRAVPAGWRIVYGEDSRQACLDYVEQHWTDLRP LSVR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgatgaacccgttcgacgacccggagggccgcttcctggtgctcgtcaacgacgaggag cagcactcgctgtggccgagccgccgggcggtacccgccggctggcggatcgtgtacggc gaggacagccggcaggcgtgtctggactacgtcgagcagcactggaccgacctgcgtccg ctgagcgtgcgctga

DBGET integrated database retrieval system