Amycolatopsis acidiphila: LWP59_02810 Help Entry LWP59_02810       CDS       T07896                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aacd  Amycolatopsis acidiphila Pathway aacd00261   Monobactam biosynthesis aacd01100   Metabolic pathways aacd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aacd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LWP59_02810  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aacd01008]     LWP59_02810 Polyketide biosynthesis proteins [BR:aacd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LWP59_02810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UIJ60634 LinkDB All DBs Position 552375..552590 Genome browser AA seq 71 aa AA seqDB search MTNPFDDDSGRFYALTNDEGQYSLWPTFAEVPSGWRVVFGEDSRQACLDHIEANWTDMRP RSLVRTMESGS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgacgaaccccttcgacgacgacagcggccggttctacgccctgaccaacgacgagggc cagtactccctgtggcccaccttcgccgaggtgccctcgggctggcgggtcgtgttcggc gaggactcgcggcaggcctgcctcgaccacatcgaggcgaactggacggacatgcggccc cgcagcctggtccgcacgatggaatccgggtcctga

DBGET integrated database retrieval system