Amycolatopsis acidiphila: LWP59_10695 Help Entry LWP59_10695       CDS       T07896                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aacd  Amycolatopsis acidiphila Pathway aacd00261   Monobactam biosynthesis aacd01100   Metabolic pathways aacd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aacd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LWP59_10695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aacd01008]     LWP59_10695 Polyketide biosynthesis proteins [BR:aacd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LWP59_10695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UIJ62051 LinkDB All DBs Position 2185944..2186150 Genome browser AA seq 68 aa AA seqDB search MSTNPFDDEAAEFLVLVNAEEQRSLWPTFAEIPAGWRAVHGPDSRAGCLAHVEATWKSIR PLSARERD NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtccaccaatccgttcgacgacgaggccgccgagttcctggtgctggtcaacgcggag gagcagcggtcgctgtggccgaccttcgcggagattcccgccggatggcgggcggtgcac gggccggacagccgcgcgggctgcctcgcccacgtcgaagccacctggaagtcgatccgc ccgctcagcgcgcgcgaaagagactga

DBGET integrated database retrieval system