Acetobacter aceti: A0U92_04475 Help Entry A0U92_04475       CDS       T04735                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism aace  Acetobacter aceti Pathway aace00260   Glycine, serine and threonine metabolism aace01100   Metabolic pathways Module aace_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:aace00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     A0U92_04475 Enzymes [BR:aace01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      A0U92_04475     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      A0U92_04475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Cys_rich_CPXG Lar_restr_allev zf-ribbon_3 Motif Other DBs NCBI-ProteinID:  AQS84147 UniProt:  A0A1U9KEI7 LinkDB All DBs Position 982290..982595 Genome browser AA seq 101 aa AA seqDB search MLLIRCPYCGERAEVEFSNGGEAHIDRPLDPMSLTDEEWAQFLYMRDNPKGLIAERWRHA HGCNRFFNAIRDTRTDRFVVTYEIGQPRPEVTPEQAAEAAR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgctgctgatccgctgcccgtattgcggggaacgagccgaagtcgaattttcaaacggg ggcgaggctcatatcgaccgcccgctggatcccatgagcctgaccgatgaggaatgggct cagtttctctacatgcgcgacaatccgaaggggctgatcgccgagcggtggcgtcatgcc cacggctgcaaccgcttcttcaacgccatccgtgacacacggacggaccgtttcgttgtc acctatgaaatcggacagccgcgtccggaagtcactccggaacaggctgcggaggctgca cgatga

DBGET integrated database retrieval system