Aureococcus anophagefferens: AURANDRAFT_33434 Help Entry AURANDRAFT_33434  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism aaf  Aureococcus anophagefferens Pathway aaf03020   RNA polymerase aaf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     AURANDRAFT_33434   09124 Replication and repair    03420 Nucleotide excision repair     AURANDRAFT_33434  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:aaf03021]     AURANDRAFT_33434    03400 DNA repair and recombination proteins [BR:aaf03400]     AURANDRAFT_33434 Transcription machinery [BR:aaf03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      AURANDRAFT_33434   RNA polymerase III system    RNA polymerase III      AURANDRAFT_33434   RNA polymerase I system    RNA polymerase I      AURANDRAFT_33434 DNA repair and recombination proteins [BR:aaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       AURANDRAFT_33434 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N YhfH Motif Other DBs NCBI-GeneID:  20221304 NCBI-ProteinID:  XP_009041410 JGI:  Auran1_33434 UniProt:  F0YLY9 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MIIPVRCFTCGKVIGNKWESYLELLKADYSEGDALDELGLKRYCCRRMVLTHVDLIEKLL NYNTLERRVTQEVPGAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatcatccccgtgcgctgcttcacgtgcggcaaggtcatcggcaacaagtgggagtcc tacctcgagctgctcaaagcggactactcggaaggcgacgcgctcgacgagctcggcctc aagcgctactgctgccggagaatggtgctcacgcacgtcgacctcatcgagaagctcctc aactacaacaccctcgagcgccgcgtcacccaggaggtgcccggcgcgcagtag

DBGET integrated database retrieval system