Aureococcus anophagefferens: AURANDRAFT_8009 Help Entry AURANDRAFT_8009   CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism aaf  Aureococcus anophagefferens Pathway aaf03020   RNA polymerase aaf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     AURANDRAFT_8009   09124 Replication and repair    03420 Nucleotide excision repair     AURANDRAFT_8009  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:aaf03021]     AURANDRAFT_8009    03400 DNA repair and recombination proteins [BR:aaf03400]     AURANDRAFT_8009 Transcription machinery [BR:aaf03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      AURANDRAFT_8009   RNA polymerase III system    RNA polymerase III      AURANDRAFT_8009   RNA polymerase I system    RNA polymerase I      AURANDRAFT_8009 DNA repair and recombination proteins [BR:aaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       AURANDRAFT_8009 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  20229174 NCBI-ProteinID:  XP_009034170 JGI:  Auran1_8009 UniProt:  F0Y1P5 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search ERVTTRYMTKYEKARVLGTRALQISMNAPVMVDVAGETDPLKIANKELRERKIPLIIRRY LPDGSYEDWPIRDLIID NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gagcgcgtcacgacgcggtacatgacgaagtacgagaaggcgcgcgtgctgggcacgcgc gcgctgcagatctccatgaacgcgccggtcatggtcgacgtcgcgggcgagacggacccc ctcaagatcgccaacaaggagctccgcgagcgcaagatcccgctcatcatccgacggtac ctgcccgacggctcctacgaggactggcccatccgggacctcatcatcgac

DBGET integrated database retrieval system