Aeromonas hydrophila MX16A: BOQ57_07970 Help Entry BOQ57_07970       CDS       T04629                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism aaj  Aeromonas hydrophila MX16A Pathway aaj00190   Oxidative phosphorylation aaj01100   Metabolic pathways aaj02020   Two-component system Module aaj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:aaj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BOQ57_07970  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BOQ57_07970 Enzymes [BR:aaj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BOQ57_07970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  APJ14867 UniProt:  A0A081USX2 LinkDB All DBs Position 1700436..1700549 Genome browser AA seq 37 aa AA seqDB search MWYFTWILGLGFALLCGLVNLLWLEARWAADEDLKES NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggattctgggactgggcttcgccctgttgtgcgggttggtcaac ctgctctggctggaggcgcgctgggccgccgatgaggatctcaaggagtcttga

DBGET integrated database retrieval system