Azospirillum argentinense: D3093_24670 Help Entry D3093_24670       CDS       T08628                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aare  Azospirillum argentinense Pathway aare00261   Monobactam biosynthesis aare01100   Metabolic pathways aare01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aare00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D3093_24670  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aare01008]     D3093_24670 Polyketide biosynthesis proteins [BR:aare01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D3093_24670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QCN98438 UniProt:  A0A4D8PRI6 LinkDB All DBs Position p2:complement(460758..460964) Genome browser AA seq 68 aa AA seqDB search MTNDQYVNPFDDESHDFLALSNAAGQFSLWPCFAAVPEGWTAVFGPAGRAACLDHIEAAW TDLTPAAA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgaccagtatgtgaaccccttcgacgacgagagtcacgacttcctggcgctg tcgaacgctgccggccagttcagcctgtggccgtgcttcgccgcggtgccggagggctgg accgccgtcttcggccccgccgggcgcgccgcctgcctcgaccatatcgaggctgcctgg accgacctcacccccgccgccgcctga

DBGET integrated database retrieval system