Acinetobacter baumannii ACICU: ACICU_02343 Help Entry ACICU_02343       CDS       T00710                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism abc  Acinetobacter baumannii ACICU Pathway abc00790   Folate biosynthesis abc01100   Metabolic pathways abc01240   Biosynthesis of cofactors Module abc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:abc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACICU_02343 Enzymes [BR:abc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACICU_02343  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACICU_02343  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACICU_02343 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF4942 Motif Other DBs NCBI-ProteinID:  ACC57655 UniProt:  A0A7U3Y152 LinkDB All DBs Position complement(2476818..2477102) Genome browser AA seq 94 aa AA seqDB search MDAIIIEGLKVETVIGCFNWERQIIQPLMLDLTIHNDLSRAAASDKLEDTLNYAQICELS AQTIQKAKPELIEHAAHLVLQCLFETFPTIEKLP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggatgccattattattgaaggcttgaaggttgagacagtgattggctgtttcaactgg gaaagacaaatcattcaacctttaatgttggatttaaccatccataatgatttgagccga gctgcagcgtctgacaagcttgaggacacactcaactatgcccagatttgtgagttatcg gctcaaaccattcagaaagccaagcctgaattaattgagcatgcagcacatctcgttctg caatgtctgtttgaaacctttccaacaattgaaaaattaccataa

DBGET integrated database retrieval system