Azospirillum brasilense Sp7: AMK58_23110 Help Entry AMK58_23110       CDS       T04566                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism abf  Azospirillum brasilense Sp7 Pathway abf00261   Monobactam biosynthesis abf01100   Metabolic pathways abf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMK58_23110  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:abf01008]     AMK58_23110 Polyketide biosynthesis proteins [BR:abf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMK58_23110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALJ38391 UniProt:  A0A0P0EQP7 LinkDB All DBs Position ABSP7_p2:complement(374954..375160) Genome browser AA seq 68 aa AA seqDB search MTNDQYVNPFDDERHDFLALANAAGQFSLWPCFAAVPEGWTAVFGPAGRAACLDHIEAAW TDLTPAAA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgaccagtatgtgaaccccttcgacgacgagcgccacgacttcctggcgttg gcgaacgctgccggccagttcagcctgtggccgtgcttcgccgcggtgccggagggctgg accgccgtcttcggccccgccgggcgcgccgcctgcctcgaccacatcgaggccgcctgg accgacctcacccccgccgccgcctga

DBGET integrated database retrieval system