Alcanivorax borkumensis: ABO_2094 Help Entry ABO_2094          CDS       T00380                                  Name (GenBank) MbtH-family protein   KO K05375   MbtH protein Organism abo  Alcanivorax borkumensis Pathway abo00261   Monobactam biosynthesis abo01100   Metabolic pathways abo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABO_2094  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:abo01008]     ABO_2094 Polyketide biosynthesis proteins [BR:abo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABO_2094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAL17542 UniProt:  Q0VMQ6 LinkDB All DBs Position complement(2399795..2399998) Genome browser AA seq 67 aa AA seqDB search MSIDNPETEFTVVINDQEQYSIWPTYRPVPAGWKTVGVTGNKTECLEHINQSWTDQRPRR LRDARAS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagtattgataatcctgaaacggaattcaccgtcgtcatcaatgaccaagaacagtac agcatctggcctacctatcgtccggttccggcaggttggaaaaccgttggtgtcactggc aacaagactgaatgtcttgagcatattaatcagagttggacggatcagcgcccacgtcgc ctgcgtgatgcgcgagcgtcctga

DBGET integrated database retrieval system