Azospirillum brasilense Az39: ABAZ39_25745 Help Entry ABAZ39_25745      CDS       T03288                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism abq  Azospirillum brasilense Az39 Pathway abq00261   Monobactam biosynthesis abq01100   Metabolic pathways abq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABAZ39_25745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:abq01008]     ABAZ39_25745 Polyketide biosynthesis proteins [BR:abq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABAZ39_25745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIB15301 UniProt:  A0A060DN11 LinkDB All DBs Position AbAZ39_p2:635851..636057 Genome browser AA seq 68 aa AA seqDB search MTNDQYVNPFDDERHDFLALANDAGQFSLWPCFAAVPEGWTAVFGPAGRAACLDHIEAAW TDLTPPAA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgaccagtatgtgaaccccttcgacgacgagcgtcacgacttcctggcgctg gcgaacgacgccggccagttcagcctgtggccgtgcttcgccgcggtgccggagggctgg accgccgtcttcggccccgccggacgcgccgcctgcctcgaccacatcgaggccgcctgg accgacctcaccccccccgccgcctga

DBGET integrated database retrieval system