Actinoalloteichus fjordicus: UA74_05185 Help Entry UA74_05185        CDS       T04639                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism acad  Actinoalloteichus fjordicus Pathway acad00261   Monobactam biosynthesis acad01100   Metabolic pathways acad01110   Biosynthesis of secondary metabolites Module acad_M00736   Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A Brite KEGG Orthology (KO) [BR:acad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     UA74_05185  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acad01008]     UA74_05185 Polyketide biosynthesis proteins [BR:acad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     UA74_05185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APU13113 LinkDB All DBs Position complement(1142074..1142286) Genome browser AA seq 70 aa AA seqDB search MNENDVDNRTYSVVVNEEEQYSIWLAGRSLPAGWNEIGHTGSKTECLDYIGEVWTDMRPK SVRQAMDARG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgaacgagaacgacgtggacaaccggacctactcggtcgtagtcaacgaggaagagcag tactcgatctggcttgccggtcgatcgctgcctgccggctggaacgaaatcggtcacacg ggcagcaagaccgaatgcctggactacatcggcgaggtctggaccgacatgcgacccaag agcgtgcggcaggcgatggacgctcgcggatag

DBGET integrated database retrieval system