Alkalicella caledoniensis: HYG86_03580 Help Entry HYG86_03580       CDS       T07204                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acae  Alkalicella caledoniensis Pathway acae00020   Citrate cycle (TCA cycle) acae01100   Metabolic pathways acae01110   Biosynthesis of secondary metabolites acae01120   Microbial metabolism in diverse environments acae01200   Carbon metabolism acae01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:acae00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HYG86_03580 Enzymes [BR:acae01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HYG86_03580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 Fer4_6 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_3 Fer4_8 Fer4_15 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  QNO13913 UniProt:  A0A7G9W5F1 LinkDB All DBs Position complement(708402..708623) Genome browser AA seq 73 aa AA seqDB search MSQPKRGKVNINYKRCKGCGICSSSCPRKVYQYKKIGRPRVVAEEKCTACMLCQYLCPDF AIKIEKIISGVVV NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgtctcagcctaagagggggaaggtcaatatcaactacaaaagatgtaagggatgtgga atctgttcctcatcttgcccaagaaaggtttaccagtacaaaaaaattggtaggccaaga gttgtagctgaagagaaatgtactgcctgtatgttatgtcagtacttatgtcctgatttt gccataaaaatagaaaaaattatcagtggggtggtagtataa

DBGET integrated database retrieval system