Acinetobacter oleivorans: AOLE_08180 Help Entry AOLE_08180        CDS       T01263                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism acd  Acinetobacter oleivorans Pathway acd00190   Oxidative phosphorylation acd01100   Metabolic pathways acd02020   Two-component system Module acd_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:acd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AOLE_08180  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AOLE_08180 Enzymes [BR:acd01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AOLE_08180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB DUF2569 Motif Other DBs NCBI-ProteinID:  ADI90527 LinkDB All DBs Position complement(1755440..1755541) Genome browser AA seq 33 aa AA seqDB search MWYFAWILGILMACFAGVLSALYIEHHQNLDEE NT seq 102 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatcctaggcattttgatggcatgttttgcgggtgtactcagt gcactttatatcgaacatcatcaaaatttagatgaggaataa

DBGET integrated database retrieval system