Pseudarthrobacter chlorophenolicus: Achl_1745 Help Entry Achl_1745         CDS       T00834                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ach  Pseudarthrobacter chlorophenolicus Pathway ach00261   Monobactam biosynthesis ach01100   Metabolic pathways ach01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ach00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Achl_1745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ach01008]     Achl_1745 Polyketide biosynthesis proteins [BR:ach01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Achl_1745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACL39726 UniProt:  B8H705 LinkDB All DBs Position complement(1962907..1963119) Genome browser AA seq 70 aa AA seqDB search MTNPFDDKSATFSVLVNEYQQHSLWPAFAAVPEGWVTMFGPDNREACLDYVSRTWTDMAP RKVSELAASQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgatgacaagtccgcaaccttctccgtactggtcaacgagtaccag cagcactccctctggccagccttcgccgccgtacccgagggctgggtgaccatgttcggc cccgacaaccgggaagcgtgccttgactacgtgtcgcggacctggacggacatggctccg cgcaaggtttccgagctcgccgcttcgcagtga

DBGET integrated database retrieval system