Aliarcobacter cibarius: ACBT_1977 Help Entry ACBT_1977         CDS       T06760                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acib  Aliarcobacter cibarius Pathway acib00790   Folate biosynthesis acib01100   Metabolic pathways acib01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:acib00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACBT_1977 (folB) Enzymes [BR:acib01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACBT_1977 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACBT_1977 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACBT_1977 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB VipB Motif Other DBs NCBI-ProteinID:  QKJ27871 UniProt:  A0A5J6RIQ7 LinkDB All DBs Position complement(1976754..1977065) Genome browser AA seq 103 aa AA seqDB search MTIYIENLTFKCIVGILDFERKKRQRVIVNLSFDYEFKDGSFIDYAEVSELVKRTMKDKK FKLLEDAVKTLSELIKNKYEVENLQLKISKPNILKDCVVSLSL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacaatttatatagagaatttaacttttaaatgtatagtaggaatacttgattttgaa aggaaaaagaggcagagagttattgtaaatcttagctttgattatgagtttaaagatggt tcttttattgattatgctgaagtttcagaacttgtaaaaaggacaatgaaagataaaaaa tttaaacttttagaggatgctgtcaagactttatcagaacttattaaaaataaatatgag gtagaaaatttacaattaaaaatttcgaagccaaatattttaaaagattgtgttgtaagt cttagtttatga

DBGET integrated database retrieval system