Acinetobacter sp. BHS4: KIP84_06595 Help Entry KIP84_06595       CDS       T09875                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acie  Acinetobacter sp. BHS4 Pathway acie00790   Folate biosynthesis acie01100   Metabolic pathways acie01240   Biosynthesis of cofactors Module acie_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:acie00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KIP84_06595 (folB) Enzymes [BR:acie01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KIP84_06595 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KIP84_06595 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KIP84_06595 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QVR69224 LinkDB All DBs Position 1385421..1385801 Genome browser AA seq 126 aa AA seqDB search MDAIIIEGLKVETVIGCFNWERQIIQPLMLDLTIHNDLSRAAESDKLEDTLNYAQICELS AQTIQQAKPELIEHAAHLVLQCLFETFPSIEKITITIRKPAIIAEANAVGIRLERTRNNF CARPSE NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggatgccattattattgaaggcttgaaagttgagacagtgattggctgtttcaactgg gaaagacaaatcattcaacctttaatgttggatttaaccattcataatgatttgagccga gcagcagagtctgacaagcttgaggacactctcaactatgcgcagatttgtgagttatcg gctcaaaccattcaacaagctaaacctgaattaatcgagcatgcagcacatctggtttta caatgtttgtttgaaacctttccatcaattgaaaaaattaccataaccatccgtaagcca gccatcattgcagaagcaaatgctgtaggaattcgtcttgaacgcaccagaaacaatttt tgcgctcgccctagcgagtaa

DBGET integrated database retrieval system