Acidovorax sp. 1608163: EAG14_19060 Help Entry EAG14_19060       CDS       T05680                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acio  Acidovorax sp. 1608163 Pathway acio00790   Folate biosynthesis acio01100   Metabolic pathways acio01240   Biosynthesis of cofactors Module acio_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:acio00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EAG14_19060 Enzymes [BR:acio01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EAG14_19060  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EAG14_19060  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EAG14_19060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AYM97824 UniProt:  A0A3G2FZH7 LinkDB All DBs Position 4286188..4286550 Genome browser AA seq 120 aa AA seqDB search MTGTQILTLTGLRFDANLGILDHEKTDPQPIQVDAELSLGVQPLAPRDDDIGHVLDYRRV RQIIIDECTAEHVNLLESLIGKLANRLMQLPGVLGVRVKIAKLEIFDDCEVAIRMETGQW NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgacaggcacgcaaatcctgacgctcaccggtttgcgctttgatgccaacctgggcatc ctcgaccacgagaaaaccgacccgcaacccatccaggtcgacgccgaactcagcctgggc gtgcagcccctggccccgcgcgacgatgacattggccatgtgctggactaccggcgtgtg cgccagatcatcattgacgagtgcaccgctgagcacgtgaacctgctcgagagcctgatc ggcaagctggccaaccgcctgatgcaactgcccggcgtgctgggcgtgcgcgtgaagatc gccaagctggaaatttttgacgactgcgaagtggcgattcgcatggaaacggggcagtgg taa

DBGET integrated database retrieval system