Actinomadura citrea: OG979_10095 Help Entry OG979_10095       CDS       T09741                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism acir  Actinomadura citrea Pathway acir00261   Monobactam biosynthesis acir01100   Metabolic pathways acir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OG979_10095  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acir01008]     OG979_10095 Polyketide biosynthesis proteins [BR:acir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OG979_10095 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WUR54274 LinkDB All DBs Position complement(2156706..2156930) Genome browser AA seq 74 aa AA seqDB search MFDDDDERTYRVVTNHEEQYSIWPEDREIPAGWRAEGTRGTKPECLAHIDQVWTDMRPLS LRRQMDSQAVPGSS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttcgatgacgacgacgagcggacctaccgggtcgtgaccaaccacgaggagcagtac tcgatctggccggaggaccgggagatcccggcggggtggcgcgcggagggcacccgggga accaagcctgagtgcctggcccacatcgaccaggtgtggacggacatgcggccactgagc ctgcgcaggcagatggattcccaggcggtccccggctcttcttga

DBGET integrated database retrieval system