Actinomadura citrea: OG979_21455 Help Entry OG979_21455       CDS       T09741                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acir  Actinomadura citrea Pathway acir00790   Folate biosynthesis acir01100   Metabolic pathways acir01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:acir00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     OG979_21455 (folB) Enzymes [BR:acir01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      OG979_21455 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      OG979_21455 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      OG979_21455 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WUR56401 LinkDB All DBs Position 4588355..4588720 Genome browser AA seq 121 aa AA seqDB search MTLDRIELRGLRARGRHGCLPAERDLGQEFVVDAVLGLDTRPAAEGDDLSRTVDYGALAG RLVAAVEGEPLNLLETLADRLAKICLEDRTVSEVEITVHKPSAPIPHPFADVAVKITRSR P NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgactctcgaccgcatcgagttgcgcgggcttcgggcgcggggccgccacggatgcctg cccgccgagcgcgacctgggccaggagttcgtcgtggacgccgtcctcggcctcgacacg cgccccgccgcggaaggcgacgacctttcgcgtaccgtcgactacggagcgctcgccggc cggctggtcgccgccgtggagggggagcccctgaacctcctcgaaacgctggccgaccgg ctggcgaagatatgtctggaagatcggacggtgtccgaggtcgagatcaccgtccacaag ccgagcgccccgatcccgcaccctttcgcggacgtcgccgtgaagatcacgaggagtcgc ccatga

DBGET integrated database retrieval system