Anaerotruncus colihominis: K5I23_00495 Help Entry K5I23_00495       CDS       T08068                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acol  Anaerotruncus colihominis Pathway acol00020   Citrate cycle (TCA cycle) acol01100   Metabolic pathways acol01110   Biosynthesis of secondary metabolites acol01120   Microbial metabolism in diverse environments acol01200   Carbon metabolism acol01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:acol00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K5I23_00495 Enzymes [BR:acol01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K5I23_00495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_15 Fer4_6 Fer4_16 Fer4_8 Fer4_13 Fer4_3 Fer4_22 Fer4_4 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  UOX65755 LinkDB All DBs Position complement(91780..91986) Genome browser AA seq 68 aa AA seqDB search MAKMTVNRDTCKGCGLCVQVCPKKIISLDKKALNQKGYHPACVEDMSKCIGCAMCAQMCP DCAITVEK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaatgacggtcaatcgggacacgtgcaagggctgcgggctttgcgtgcaggtc tgccctaagaaaattatttctcttgacaaaaaggcgctgaaccagaaggggtatcatcct gcctgcgtcgaggacatgagcaagtgcatcgggtgtgcgatgtgcgctcagatgtgtccg gactgcgcgattacggttgagaaatag

DBGET integrated database retrieval system