Anaerotruncus colihominis: K5I23_00910 Help Entry K5I23_00910       CDS       T08068                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism acol  Anaerotruncus colihominis Pathway acol00010   Glycolysis / Gluconeogenesis acol00020   Citrate cycle (TCA cycle) acol00620   Pyruvate metabolism acol00640   Propanoate metabolism acol00650   Butanoate metabolism acol00680   Methane metabolism acol01100   Metabolic pathways acol01110   Biosynthesis of secondary metabolites acol01120   Microbial metabolism in diverse environments acol01200   Carbon metabolism acol01210   2-Oxocarboxylic acid metabolism Module acol_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:acol00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     K5I23_00910    00020 Citrate cycle (TCA cycle)     K5I23_00910    00620 Pyruvate metabolism     K5I23_00910    00640 Propanoate metabolism     K5I23_00910    00650 Butanoate metabolism     K5I23_00910   09102 Energy metabolism    00680 Methane metabolism     K5I23_00910   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     K5I23_00910 Enzymes [BR:acol01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      K5I23_00910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_9 Fer4_21 Fer4_16 Fer4_10 Fer4_4 Fer4_17 Fer4_3 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  UOX65835 LinkDB All DBs Position 178460..178768 Genome browser AA seq 102 aa AA seqDB search MSHLAKDMTPSVTWKEITPGCNIFEGGTSQVVETGDWRTIKPVIDWAKCKQCLLCAPVCP DMSIPVNKEGKREDFDYFFCKGCGICANACPFGAITMVKDEK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagccatctggcaaaggatatgacgcccagcgtcacttggaaagagatcacccccggc tgcaatatttttgagggcggcacatcccaggtcgtggagaccggcgactggcgcaccata aagcctgtcattgactgggcgaagtgtaagcaatgcctgctgtgcgccccggtctgcccg gatatgtccatccccgtgaacaaggaaggcaagcgggaggattttgactatttcttctgc aaaggctgcgggatctgcgcgaacgcctgccccttcggggccatcaccatggtcaaggat gaaaagtaa

DBGET integrated database retrieval system