Alistipes communis: A5CBH24_24450 Help Entry A5CBH24_24450     CDS       T06592                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acou  Alistipes communis Pathway acou00020   Citrate cycle (TCA cycle) acou01100   Metabolic pathways acou01110   Biosynthesis of secondary metabolites acou01120   Microbial metabolism in diverse environments acou01200   Carbon metabolism acou01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:acou00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A5CBH24_24450 Enzymes [BR:acou01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A5CBH24_24450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_6 Fer4_10 Fer4_4 Fer4_9 Fer4_15 Fer4_16 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  BBL05132 UniProt:  A0A3D3YNJ6 LinkDB All DBs Position complement(3046127..3046354) Genome browser AA seq 75 aa AA seqDB search MAKIKGTIVVDKERCKGCGVCVASCPCDVLALSVEVNNKGYRMCMMAHPDACTGCASCAI ICPDSCITVYRQKFE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaagataaaaggaacgattgtcgttgataaagaacgctgtaagggttgcggcgtc tgcgtggcatcgtgtccgtgcgacgtgctggccctttcggtcgaagtcaacaacaagggg tatcgcatgtgcatgatggcgcaccccgacgcctgtacgggctgcgcttcgtgtgcgatc atctgtccggacagttgtattacggtataccggcaaaaattcgaatag

DBGET integrated database retrieval system