Actinomyces sp. oral taxon 414: AM609_15005 Help Entry AM609_15005       CDS       T04083                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism acq  Actinomyces sp. oral taxon 414 Pathway acq00261   Monobactam biosynthesis acq01100   Metabolic pathways acq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AM609_15005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acq01008]     AM609_15005 Polyketide biosynthesis proteins [BR:acq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AM609_15005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALD00410 UniProt:  A0A0M4GR57 LinkDB All DBs Position 3730821..3731027 Genome browser AA seq 68 aa AA seqDB search MNPFDDPNGEFLVLVNAENQHSIWPVFADVPDGWRQVAGPLGRDAAIEWVDANWTDMRPA SLIAAMKK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgatgaccccaacggcgagttcctggttctcgtcaacgccgagaatcag cattccatctggcccgtgttcgcagatgtccccgacgggtggcggcaagtggccggaccc ctcgggcgggacgccgcaatagaatgggtggatgccaactggaccgatatgcgacccgcg tcgctcatcgctgcgatgaagaagtag

DBGET integrated database retrieval system