Acidovorax sp. RAC01: BSY15_1986 Help Entry BSY15_1986        CDS       T04481                                  Name (GenBank) FolB domain protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acra  Acidovorax sp. RAC01 Pathway acra00790   Folate biosynthesis acra01100   Metabolic pathways acra01240   Biosynthesis of cofactors Module acra_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:acra00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BSY15_1986 Enzymes [BR:acra01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BSY15_1986  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BSY15_1986  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BSY15_1986 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOG24697 UniProt:  A0A1B3PPJ2 LinkDB All DBs Position complement(2205610..2205981) Genome browser AA seq 123 aa AA seqDB search MTDAAGTQILTLTGLRFDANLGILDHERTAPQPIQVDAELNQGRQPLLPHDDDISHVLDY RKVRQIIIDECTAEHVNLLESLIGKLAKRLMQLPGVRGVRVKIAKLEIFDDCEVAIRVET GQW NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgacagacgctgcaggcacccagatcctcacgctcaccggtttgcgctttgatgccaac ctgggcatcctcgaccacgagcgcaccgccccccagcccatccaggtcgatgccgagctg aaccagggccgccagccgctgctgccgcacgacgacgacatcagccacgtgctggactac cgcaaggtgcgccagatcatcatcgacgagtgcacggccgagcacgtgaatctgctcgag agcctgatcggcaagctcgccaagcgcctgatgcagctgcccggcgtgcggggcgtgcgg gtgaagattgcgaagctggaaatttttgacgactgcgaagtggccattcgcgtcgagaca ggacagtggtga

DBGET integrated database retrieval system