Actinoalloteichus sp. AHMU CJ021: C1701_02825 Help Entry C1701_02825       CDS       T05306                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism acta  Actinoalloteichus sp. AHMU CJ021 Pathway acta00261   Monobactam biosynthesis acta01100   Metabolic pathways acta01110   Biosynthesis of secondary metabolites Module acta_M00736   Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A Brite KEGG Orthology (KO) [BR:acta00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C1701_02825  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acta01008]     C1701_02825 Polyketide biosynthesis proteins [BR:acta01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C1701_02825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUS77482 LinkDB All DBs Position 780349..780570 Genome browser AA seq 73 aa AA seqDB search MTKGTKGTTGAEATHHRFLVLGNETGQYSVRPAFAEVPSGWTVAFGADTRRNCLDFLVSR CPVAPGRGSFRAG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaaggggacgaaggggaccacgggcgcggaggcgacgcaccaccggttcctggtg ttggggaacgagacggggcagtactcggtgcggccggcgttcgccgaggtgcccagcggc tggacggtggcgttcggggcggacaccaggaggaactgcctggatttcctggtctcgcgg tgcccggtcgccccggggaggggctcgttccgggcagggtga

DBGET integrated database retrieval system