Actinoalloteichus sp. AHMU CJ021: C1701_23425 Help Entry C1701_23425       CDS       T05306                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism acta  Actinoalloteichus sp. AHMU CJ021 Pathway acta00261   Monobactam biosynthesis acta01100   Metabolic pathways acta01110   Biosynthesis of secondary metabolites Module acta_M00736   Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A Brite KEGG Orthology (KO) [BR:acta00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C1701_23425  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acta01008]     C1701_23425 Polyketide biosynthesis proteins [BR:acta01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C1701_23425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUS81981 LinkDB All DBs Position 5543118..5543351 Genome browser AA seq 77 aa AA seqDB search MGENEDTAEFEVVVNDEEQYSVWPVGREVPAGWRAVGQRGPKRHCLAWIDENWTDMRPRA LRAALAGTGTAGTGEPA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt ctgggagaaaacgaggacaccgccgagttcgaggtcgtcgtcaacgacgaggaacagtat tccgtgtggccggtcggacgggaggtcccggccgggtggcgtgccgtgggccagcggggt ccgaaacggcactgcctggcctggatcgacgagaactggacggacatgcggccgcgcgcc ctccgcgcggcgctcgcgggcaccggcaccgccgggacgggagagccggcttga

DBGET integrated database retrieval system