Actimicrobium sp. CCC2.4: RHM62_11740 Help Entry RHM62_11740       CDS       T09612                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism actb  Actimicrobium sp. CCC2.4 Pathway actb00400   Phenylalanine, tyrosine and tryptophan biosynthesis actb01100   Metabolic pathways actb01110   Biosynthesis of secondary metabolites actb01230   Biosynthesis of amino acids Module actb_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine actb_M00025   Tyrosine biosynthesis, chorismate => HPP => tyrosine Brite KEGG Orthology (KO) [BR:actb00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     RHM62_11740 Enzymes [BR:actb01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      RHM62_11740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  WPX30929 LinkDB All DBs Position 2542605..2542865 Genome browser AA seq 86 aa AA seqDB search MKKYREEIDRIDDALFSALAMRFQITDKVGALKKAEKLPPVDPQREAEQEKRLLEIAKRA GLREDIARSFLRFIIDTVVEDHKKAK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttgaaaaaatatcgtgaagaaatagaccgaatcgacgatgcgctttttagcgcccttgcg atgcgatttcaaataacggataaggttggggcgctaaaaaaagcggaaaaactacctccg gttgacccacagcgagaggccgagcaagaaaaaagactgctagagatcgcgaagagagca ggactgcgggaggacatagcgcgctcattcctccgtttcatcattgacaccgttgtggaa gaccacaagaaggctaaataa

DBGET integrated database retrieval system