Actinoalloteichus sp. GBA129-24: UA75_05190 Help Entry UA75_05190        CDS       T04619                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism acti  Actinoalloteichus sp. GBA129-24 Pathway acti00261   Monobactam biosynthesis acti01100   Metabolic pathways acti01110   Biosynthesis of secondary metabolites Module acti_M00736   Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A Brite KEGG Orthology (KO) [BR:acti00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     UA75_05190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acti01008]     UA75_05190 Polyketide biosynthesis proteins [BR:acti01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     UA75_05190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APU19064 UniProt:  A0A1L7F2M9 LinkDB All DBs Position complement(1130042..1130254) Genome browser AA seq 70 aa AA seqDB search MNENDVDNRTYSVVVNEEEQYSIWLAGRSLPAGWNEIGHTGSKTECLDYIGEVWTDMRPK SVRQAMDARG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgaacgagaacgacgtggacaaccggacctactcggtcgtagtcaacgaggaagagcag tactcgatctggcttgccggtcgatcgctgcctgccggctggaacgaaatcggtcacacg ggcagcaagaccgaatgcctggactacatcggcgaggtctggaccgacatgcgacccaag agcgtgcggcaggcgatggacgctcgcggatag

DBGET integrated database retrieval system