Actinoplanes sp. L3-i22: L3i22_035500 Help Entry L3i22_035500      CDS       T08939                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism actl  Actinoplanes sp. L3-i22 Pathway actl00261   Monobactam biosynthesis actl01100   Metabolic pathways actl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L3i22_035500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actl01008]     L3i22_035500 Polyketide biosynthesis proteins [BR:actl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L3i22_035500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCY08462 LinkDB All DBs Position 3986486..3986707 Genome browser AA seq 73 aa AA seqDB search MTTNPFEDEDGRYLVLVNDERQHSLWPAFADVPAGWTVAFGEDSRAACFDYVEKNWTDMR PASLVAQMDAAAG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgacgaccaacccgttcgaggacgaggacggccggtacctggtgctggtcaacgacgag cgccagcactcgctctggccggcgttcgccgacgtgccggccggctggacggtcgcgttc ggcgaggacagccgggccgcctgcttcgattacgtcgagaagaactggaccgacatgcgg cccgcgtcgctcgtcgcccagatggacgccgcagccggctga

DBGET integrated database retrieval system