Actinoplanes sp. L3-i22: L3i22_047540 Help Entry L3i22_047540      CDS       T08939                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism actl  Actinoplanes sp. L3-i22 Pathway actl00261   Monobactam biosynthesis actl01100   Metabolic pathways actl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L3i22_047540 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actl01008]     L3i22_047540 (mbtH) Polyketide biosynthesis proteins [BR:actl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L3i22_047540 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CxC7 Motif Other DBs NCBI-ProteinID:  BCY09666 LinkDB All DBs Position complement(5293529..5293732) Genome browser AA seq 67 aa AA seqDB search MTRDEDATRRYRVVINQEEQYSVWPADRDLPPGWTGEGREGTRQECLDHIGRVWTDMRPL SLRRRMG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgactcgtgatgaggacgcgacgaggcgctatcgggtcgtgatcaatcaggaggagcag tattcggtctggccggccgaccgggacctgccgcccggctggaccggcgagggccgcgag ggcacccggcaggagtgcctcgaccacatcggccgggtgtggaccgacatgcggccgctg agcctgcgaaggaggatggggtga

DBGET integrated database retrieval system