Actinoplanes sp. N902-109: L083_5572 Help Entry L083_5572         CDS       T02655                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism actn  Actinoplanes sp. N902-109 Pathway actn00261   Monobactam biosynthesis actn01100   Metabolic pathways actn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L083_5572  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actn01008]     L083_5572 Polyketide biosynthesis proteins [BR:actn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L083_5572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGL19082 UniProt:  R4LI97 LinkDB All DBs Position complement(6386145..6386351) Genome browser AA seq 68 aa AA seqDB search MTGQNTGTRYTVVVNDEEQYSIWAADRALPAGWHAAGTSGTREECLAEIGRVWTDLRPRS LRRAMGEL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccgggcagaacaccggaacccgctacaccgtcgtcgtcaacgacgaggagcagtac tccatctgggcggccgaccgggcgctgccggccggctggcacgccgccggcaccagcggc acccgggaggaatgcctggccgagatcggccgggtgtggaccgacctgcgaccgcgcagc ctgcgccgggcgatgggagagctgtga

DBGET integrated database retrieval system