Actinoplanes sp. NBRC 14428: Asp14428_16880 Help Entry Asp14428_16880    CDS       T08315                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism actr  Actinoplanes sp. NBRC 14428 Pathway actr00261   Monobactam biosynthesis actr01100   Metabolic pathways actr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Asp14428_16880  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actr01008]     Asp14428_16880 Polyketide biosynthesis proteins [BR:actr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Asp14428_16880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ50213 LinkDB All DBs Position 1794422..1794619 Genome browser AA seq 65 aa AA seqDB search MFEDDDDREYRVVRNDEEQYSIWPVTHDLPPGWQEAGPRGDKAACLRHIGEVWTDLRPLS ARSGA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgttcgaggacgacgacgaccgggagtaccgggtggtccgcaacgacgaggagcagtac tcgatctggcccgtcacgcacgacctgccgcccggctggcaggaggccggcccgcgcggc gacaaggccgcctgcctgcggcacatcggcgaggtgtggaccgacctgcgtccgctcagt gcgcgtagcggtgcctga

DBGET integrated database retrieval system