Actinoplanes sp. NBRC 14428: Asp14428_17990 Help Entry Asp14428_17990    CDS       T08315                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism actr  Actinoplanes sp. NBRC 14428 Pathway actr00261   Monobactam biosynthesis actr01100   Metabolic pathways actr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Asp14428_17990  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actr01008]     Asp14428_17990 Polyketide biosynthesis proteins [BR:actr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Asp14428_17990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ50324 LinkDB All DBs Position 1908976..1909197 Genome browser AA seq 73 aa AA seqDB search MSNPFEREDISYFVLVNDEGQHSLWPEVIDVPAGWRTVLGPESRDACLAHIETSWWDIRP ASLVARMTAAKSA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaacgcgaggacatcagctacttcgtgctggtcaacgacgagggg cagcattcgctctggccggaggtgatcgacgtgccggccggctggcgtacggtcctgggg ccggagagccgcgacgcgtgcctcgcgcacatcgagacgtcgtggtgggacatccggccc gcgagcctggtcgcccggatgaccgcggccaagagcgcgtga

DBGET integrated database retrieval system