Actinoplanes sp. NBRC 14428: Asp14428_21680 Help Entry Asp14428_21680    CDS       T08315                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism actr  Actinoplanes sp. NBRC 14428 Pathway actr00261   Monobactam biosynthesis actr01100   Metabolic pathways actr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Asp14428_21680  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actr01008]     Asp14428_21680 Polyketide biosynthesis proteins [BR:actr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Asp14428_21680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ50693 LinkDB All DBs Position 2346533..2346721 Genome browser AA seq 62 aa AA seqDB search MDDEDDDRVFQVVVNHEEQYALWPAHLPLPAGWRASGCTGRREECLEYVAEVWTDLRPRS LR NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaggacgacgaccgggtcttccaggtggtggtcaaccacgaggagcagtac gcgctgtggccggctcacctgccgctgccggccggatggcgggcgagcgggtgcaccggc cgtcgcgaggagtgcctggagtacgtggccgaggtgtggacggatctgcgcccgcggagc ctgcgctga

DBGET integrated database retrieval system