Actinoplanes sp. NBRC 14428: Asp14428_49180 Help Entry Asp14428_49180    CDS       T08315                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism actr  Actinoplanes sp. NBRC 14428 Pathway actr00261   Monobactam biosynthesis actr01100   Metabolic pathways actr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Asp14428_49180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actr01008]     Asp14428_49180 Polyketide biosynthesis proteins [BR:actr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Asp14428_49180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ53443 LinkDB All DBs Position 5286851..5287066 Genome browser AA seq 71 aa AA seqDB search MGNPFDDTEGRFLVLVNDEGQYSMWPAAIDVPAGWTVAHPEDSHQACLDYVEQNWTDMRP RSLVRAMGEES NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgggtaacccgttcgacgacaccgagggccgattcctggtgctggtcaacgacgagggt cagtactcgatgtggccggcggcgatcgacgtgccggcagggtggaccgtcgcccacccc gaggacagccatcaggcgtgcctcgactacgtcgagcagaactggaccgacatgcgcccg cggagccttgtccgcgccatgggtgaggagtcctga

DBGET integrated database retrieval system