Actinokineospora sp. UTMC 2448: Actkin_02941 Help Entry Actkin_02941      CDS       T08397                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism actu  Actinokineospora sp. UTMC 2448 Pathway actu00261   Monobactam biosynthesis actu01100   Metabolic pathways actu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Actkin_02941  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actu01008]     Actkin_02941 Polyketide biosynthesis proteins [BR:actu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Actkin_02941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UVS79195 LinkDB All DBs Position 3205141..3205344 Genome browser AA seq 67 aa AA seqDB search MRDDITYQVLVNDEGQYSLWPADHEIPAGWHAEGTTGTKEDCSAHVDRVWTDMRPLSLRK HMEANPT NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagggacgacatcacctaccaggtcctcgtgaacgacgagggccagtactccctgtgg ccagccgaccacgagatccccgcgggctggcacgccgaaggcaccaccggcaccaaggag gactgctcggcccacgtcgaccgcgtgtggaccgacatgcgcccgctcagcctccgcaag cacatggaggccaacccgacctga

DBGET integrated database retrieval system