Actinomadura sp. WMMB 499: F7P10_04515 Help Entry F7P10_04515       CDS       T06213                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism actw  Actinomadura sp. WMMB 499 Pathway actw00261   Monobactam biosynthesis actw01100   Metabolic pathways actw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F7P10_04515  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actw01008]     F7P10_04515 Polyketide biosynthesis proteins [BR:actw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F7P10_04515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFG20530 UniProt:  A0A5J6TZ68 LinkDB All DBs Position complement(1053749..1053958) Genome browser AA seq 69 aa AA seqDB search MTNPFEDPDGTYLVLVNDEGQHSLWPSFAAVPAGWTVAKEEDTRQACLDHINENWTDMRP KSLIEAMGD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgaggaccccgacggcacgtacctcgtgctcgtcaacgacgagggc cagcactcgctgtggccgtccttcgccgcggttcccgcgggctggacggtcgcgaaggag gaggacacccggcaggcgtgcctcgaccacatcaacgagaactggacggacatgcggccc aagagcctcatcgaggccatgggtgactag

DBGET integrated database retrieval system