Actinomadura sp. WMMB 499: F7P10_33420 Help Entry F7P10_33420       CDS       T06213                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism actw  Actinomadura sp. WMMB 499 Pathway actw00261   Monobactam biosynthesis actw01100   Metabolic pathways actw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F7P10_33420  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:actw01008]     F7P10_33420 Polyketide biosynthesis proteins [BR:actw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F7P10_33420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFG25324 UniProt:  A0A5J6UEN6 LinkDB All DBs Position complement(7421417..7421677) Genome browser AA seq 86 aa AA seqDB search MPQNPFDDDSGSFYALVNQEEQYSLWPTFKPVPGGWTIVFGAPDGAPRQEVLDWIDGTWT DLRPKSLRDFIAEQEGAAQNATPTGN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcctcaaaatccttttgacgacgacagcggcagtttctacgccctcgtcaatcaggag gagcagtactccctctggccgaccttcaagccggttcccggtggctggacgatcgttttc ggcgcccccgacggggctccgcgccaggaggtcctcgactggatcgacggcacctggacc gaccttcgtcccaagtcccttcgcgacttcatcgccgagcaagagggcgcggcgcagaac gcgacccccaccggcaactga

DBGET integrated database retrieval system