Actinomycetospora sp. NBC_00405: OG774_12270 Help Entry OG774_12270       CDS       T09735                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism acty  Actinomycetospora sp. NBC_00405 Pathway acty00261   Monobactam biosynthesis acty01100   Metabolic pathways acty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acty00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OG774_12270  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acty01008]     OG774_12270 Polyketide biosynthesis proteins [BR:acty01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OG774_12270 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WUI64086 LinkDB All DBs Position 2486146..2486388 Genome browser AA seq 80 aa AA seqDB search MPNPFDDPDGRFLVLVNDEGQHSLWPVFADVPAGWTVVFGQDSPGDAPGADRAAALEYVE QHWTDMRPRSLVEQMERAEG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgcccaaccccttcgacgaccccgacggccgcttcctcgtcctcgtgaacgacgagggg cagcacagcctctggccggtcttcgccgacgtcccggcgggatggacggtcgtgttcggt caggactcccccggcgacgccccgggcgccgaccgggccgccgcgctcgagtacgtcgag cagcactggaccgacatgcgcccgcgcagcctcgtcgagcagatggagcgggcggagggc tga

DBGET integrated database retrieval system