Athene cunicularia (burrowing owl): 113481284 Help Entry 113481284         CDS       T05777                                  Symbol FTH1 Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism acun  Athene cunicularia (burrowing owl) Pathway acun00860   Porphyrin metabolism acun04216   Ferroptosis acun04217   Necroptosis Brite KEGG Orthology (KO) [BR:acun00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     113481284 (FTH1)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     113481284 (FTH1)    04217 Necroptosis     113481284 (FTH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113481284 (FTH1) Enzymes [BR:acun01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      113481284 (FTH1) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113481284 (FTH1)   Exosomal proteins of bladder cancer cells    113481284 (FTH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin YppF Motif Other DBs NCBI-GeneID:  113481284 NCBI-ProteinID:  XP_026706594 LinkDB All DBs Position 5 AA seq 113 aa AA seqDB search MKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPHL CDFIETHYLDEQVKSIKELGDHVTNLRKMGAPKYGMAEYLFDKHTLGDSDNES NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaaactacagaatcagagaggtggacgcatcttcttgcaggacatcaagaagccagat cgtgatgactgggagaatggcctgactgcaatggagtgtgccctccacctggagaagaat gtgaaccagtcactgttagaactgcacaaattggcaactgaaaagaatgacccacacttg tgtgacttcattgagactcactacctggatgaacaggtgaagtccatcaaagagctgggt gaccatgtgaccaacctgcggaagatgggggcaccaaaatatggcatggcagagtacctc tttgacaagcacaccctaggggacagtgacaatgagagctga

DBGET integrated database retrieval system