Alicyclobacillus curvatus: JZ785_17750 Help Entry JZ785_17750       CDS       T08166                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acur  Alicyclobacillus curvatus Pathway acur00020   Citrate cycle (TCA cycle) acur01100   Metabolic pathways acur01110   Biosynthesis of secondary metabolites acur01120   Microbial metabolism in diverse environments acur01200   Carbon metabolism acur01210   2-Oxocarboxylic acid metabolism Module acur_M00009   Citrate cycle (TCA cycle, Krebs cycle) acur_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:acur00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JZ785_17750 Enzymes [BR:acur01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JZ785_17750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_2 Fer4_9 Fer4_6 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_13 Fer4_3 Fer4_22 Fer4_18 Fer4_15 Motif Other DBs NCBI-ProteinID:  QSO55225 LinkDB All DBs Position complement(3735976..3736191) Genome browser AA seq 71 aa AA seqDB search MGKVTFNEDVCKGCGLCMEACPKHIIQFSDKLNLKGYHFATVSDEAMDECIACTFCAIMC PDVAIEVSLSQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atcggtaaagtgacattcaatgaggatgtctgtaaaggttgtgggctttgcatggaagcg tgcccgaagcacatcattcagttttcagacaagttgaacctgaagggctatcactttgcg acggtgagcgatgaagcgatggatgagtgtatcgcctgcacgttctgcgccatcatgtgc ccggatgttgcgattgaagtcagtttgtcacagtaa

DBGET integrated database retrieval system