Azotobacter chroococcum: Achr_39010 Help Entry Achr_39010        CDS       T03640                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism acx  Azotobacter chroococcum Pathway acx00261   Monobactam biosynthesis acx01100   Metabolic pathways acx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Achr_39010  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acx01008]     Achr_39010 Polyketide biosynthesis proteins [BR:acx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Achr_39010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJE23287 UniProt:  A0A0C4WWG9 LinkDB All DBs Position complement(4361495..4361698) Genome browser AA seq 67 aa AA seqDB search MNYDPADTQFHVVVNAEQQYSIWPEYKAMPAGWQEIGISGDRQACLAYVSGIWTDLSRRS LRDAMAE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaattacgacccagccgatacccagttccacgtggtggtcaacgccgagcagcagtac tcgatctggccggaatacaaggcaatgccggccggctggcaggagatcggcatcagcggc gaccgccaggcctgcctggcctacgtctccgggatctggaccgacctgtcccggcgcagc ctgcgcgacgccatggccgagtga

DBGET integrated database retrieval system