Acidithiobacillus caldus ATCC 51756: Acaty_m0184 Help Entry Acaty_m0184       CDS       T03561                                  Name (GenBank) Sarcosine oxidase delta subunit   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism acz  Acidithiobacillus caldus ATCC 51756 Pathway acz00260   Glycine, serine and threonine metabolism acz01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:acz00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     Acaty_m0184 Enzymes [BR:acz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      Acaty_m0184     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      Acaty_m0184 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  AIA56757 UniProt:  A0A060A3Z7 LinkDB All DBs Position mpAca1.1:149628..149885 Genome browser AA seq 85 aa AA seqDB search MKMLPCPICGTRNLAEFLYYGVRRSMPDPTQCSDAEWARHLFFRQGAAGVKEEWWCHLPC NEWFAIRRDTATDEILGSARMGDPT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaagatgttgccttgtccgatttgtggcacccgaaatcttgcggaatttttgtattat ggggtacgtcgctcgatgccagatccgacacaatgcagcgacgctgaatgggcgcgccac ctcttcttccgccaaggcgctgcgggggtcaaggaggaatggtggtgccacctgccctgc aacgagtggtttgcgatccggcgggatacggcgactgatgagatcttaggctcggcccgg atgggggatccgacatga

DBGET integrated database retrieval system