Actinopolyspora erythraea: CDG81_21525 Help Entry CDG81_21525       CDS       T05020                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aey  Actinopolyspora erythraea Pathway aey00261   Monobactam biosynthesis aey01100   Metabolic pathways aey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aey00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CDG81_21525  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aey01008]     CDG81_21525 Polyketide biosynthesis proteins [BR:aey01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CDG81_21525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASU80422 UniProt:  A0A099D9Q8 LinkDB All DBs Position 4900523..4900693 Genome browser AA seq 56 aa AA seqDB search MTEHTEPERYVVVVNDRGQYSIWERESAPPAGWYDAGFEGDRDDCLAHIERTWRDI NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgacggaacacaccgaacccgaacgctacgtcgtggtcgtcaacgatcgcggccagtac tccatctgggagcgggagtcggcgccacccgccgggtggtacgacgccggattcgagggc gaccgggacgactgcctcgctcacatcgagcgaacctggcgagacatctga

DBGET integrated database retrieval system