Actinoplanes friuliensis: AFR_23665 Help Entry AFR_23665         CDS       T02892                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism afs  Actinoplanes friuliensis Pathway afs00261   Monobactam biosynthesis afs01100   Metabolic pathways afs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afs00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AFR_23665  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:afs01008]     AFR_23665 Polyketide biosynthesis proteins [BR:afs01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AFR_23665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGZ43001 UniProt:  U5W4Y1 LinkDB All DBs Position complement(5108244..5108450) Genome browser AA seq 68 aa AA seqDB search MSTNPFDNAEGMFLVLVNDENQHSLWPVFAEVPAGWRTTHGPAGRQDCLDHINTTWTDMR PQSLIDAS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgacaacgccgaaggtatgttcctcgtgctggtcaacgacgag aaccagcacagcctgtggccggtcttcgccgaggtaccggccggctggcgcacgacacac ggcccggccggacgccaggactgcctggaccacatcaacaccacctggacggacatgcgc ccgcaaagcctgatcgatgcctcctga

DBGET integrated database retrieval system