Anoxybacter fermentans: BBF96_05070 Help Entry BBF96_05070       CDS       T05768                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism aft  Anoxybacter fermentans Pathway aft00020   Citrate cycle (TCA cycle) aft01100   Metabolic pathways aft01110   Biosynthesis of secondary metabolites aft01120   Microbial metabolism in diverse environments aft01200   Carbon metabolism aft01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:aft00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BBF96_05070 Enzymes [BR:aft01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BBF96_05070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_7 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_8 Fer4_3 Fer4_17 ETF_QO Motif Other DBs NCBI-ProteinID:  AZR72818 UniProt:  A0A3Q9HPT1 LinkDB All DBs Position complement(1137344..1137553) Genome browser AA seq 69 aa AA seqDB search MARRKGKVSIRSEWCKGCNICVSFCPTGVLALEKNVAVLVAPEKCVGCMLCELRCPDYAI SVEVVKNDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggccaggcggaaaggcaaggtttctattagatcagaatggtgtaaaggatgcaatata tgtgtctctttctgtccaaccggagtattggcattagagaaaaatgttgcagttttagta gctcctgaaaaatgtgttggatgtatgttatgtgaactgcgctgtcctgattatgcaatt tctgttgaggtggtgaagaatgatggctga

DBGET integrated database retrieval system