Alicyclobacillus mengziensis: JZ786_01885 Help Entry JZ786_01885       CDS       T07322                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism afx  Alicyclobacillus mengziensis Pathway afx00020   Citrate cycle (TCA cycle) afx01100   Metabolic pathways afx01110   Biosynthesis of secondary metabolites afx01120   Microbial metabolism in diverse environments afx01200   Carbon metabolism afx01210   2-Oxocarboxylic acid metabolism Module afx_M00009   Citrate cycle (TCA cycle, Krebs cycle) afx_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:afx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JZ786_01885 Enzymes [BR:afx01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JZ786_01885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_6 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_22 Fer4_13 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  QSO49629 UniProt:  A0A9X7W2V8 LinkDB All DBs Position 436632..436847 Genome browser AA seq 71 aa AA seqDB search MGEVTFSEDVCKGCGLCMEVCPKHIIQFSDKLNLKGYHFATVHDEDMDECIACTFCAIMC PDVAIEVSLSK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atcggagaagtgacattcagtgaggatgtctgtaaaggttgtgggctttgcatggaagtg tgccccaagcacatcattcaattttccgacaagttaaatctcaagggctatcactttgcg acggttcatgatgaggacatggatgagtgtatcgcctgcacgttctgcgccatcatgtgt cctgatgtggcgattgaagtaagcctgtcaaagtag

DBGET integrated database retrieval system