Agrobacterium sp. RAC06: BSY240_363 Help Entry BSY240_363        CDS       T04501                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism agc  Agrobacterium sp. RAC06 Pathway agc00790   Folate biosynthesis agc01100   Metabolic pathways agc01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:agc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BSY240_363 (folB) Enzymes [BR:agc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BSY240_363 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BSY240_363 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BSY240_363 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOG11818 UniProt:  A0A1B3P2J8 LinkDB All DBs Position 391156..391527 Genome browser AA seq 123 aa AA seqDB search MSGVFTITLKNCAFFAHHGVFPEEGVLGQRFFVDAEFDVDAIAAAETDTLDGTVHYGIAF EVIRDIVTGSRRQLIEALALAIARGLLDRFPEMLRCRITVRKPSAPIAGILDHVQVSVEQ VRS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagcggtgttttcaccatcaccctgaagaattgcgctttcttcgcccatcacggcgtt ttcccggaggagggggtgcttggacagcgtttcttcgtcgatgcggagttcgacgtggac gcgattgctgccgcagagaccgatacgctcgatgggaccgtgcattacggcattgccttc gaggtgatccgcgacatcgtcaccggcagccgccggcagttgatcgaggcgctggcgctg gccattgcgcgcggactgctcgaccgtttccctgaaatgctgcgctgccggatcacggtg cgcaagccgagcgcgccgatcgccggcatccttgaccatgtgcaggtgagcgttgaacaa gtcagaagttaa

DBGET integrated database retrieval system